himekawa




FC2GMEMONEZSSISDASDAWDSHKDMEYDMARAAVSAWAAAMVSDDASDVEMAHZGDAMBICAWDJULHMNNACXKSBJ

2020-09-25
272 min

[SKMJ-125]This Horny Little Stepbrother Has Been Secretly Filming His Divine Titty Big Stepsister During Her Most Private Moments! He Could Only Get Such Private Footage Up Close While At Home, And She Looks Completely Unguarded, Flashing Panty Shot

  • censoredbig titsamateurSKMJred face girlyosukeSKMJ-125SKMJ125h-1324skmj00125
    • 2020-09-29
    81 min

    200GANA-2360 Seriously flexible, first shot. 1534 [God development] In front of Akiba station ● Beautiful office lady who picked up Riko! Actually, it was a bad guy making machine that loves service and loves sex! ？？ If you practice it in the hotel r

  • amateur censoredamateurganagana-2360gana2360200gana-2360
    • 2020-10-03
    241 min

    [DVDMS-585]18 Year Old Fresh Face Raised With A Pure Heart And Body Kasumi Tsukino AV Debut Documentary Born In Kamakura And Lived A Sheltered Life. This Princess College Girl Who Rejected The Magic Mirror Bus Fucks In Front Of The Camera--

  • kasumi tsukino censoredbig titsbeautiful girlDVDMSdeep sgreenhouse effectDVDMS-585DVDMS585dvdms00585
    • 2020-10-10
    156 min

    [IPIT-008]Princess In The Streets, Slut In The Sheets - High Class Massage Parlor Hooker's Porn Debut Aya Shiomi

  • aya shiomi censoreddeepthroatsingle workIPITidea pocketmametaro mamezawaideapocket talent discovery projectIPIT-008IPIT008ipit00008
    • 2020-10-23
    63 min

    417SRCN-040 Beautiful Cuckold F Breasts Best Friend Cuckold SEX Until Morning With Her! Even though my best friend is right next to me, I was addicted to my cock and cum shot many times to her and the semen is empty w

  • amateuramateur censoredcreampiebig titssrcnsrcn-040srcn040417srcn-040
    • 2020-10-24
    146 min

    [DASD-752]The Domain Of Her Holy Golden Waters This Beautiful Secretary Received Breaking In Pissing Training From Her Critical President And Now She's Dripping Piss Down Her Marshmallow-Soft Skin And Thighs. Rika Tsubaki

  • tsubaki rika censoredbeautiful girlsingle workDASDdasgoemonDASD-752DASD752dasd00752
    • 2020-10-30
    53 min

    483HMHI-588 Wakana 2

  • amateur censoredbig titsamateurhmhihmhi-588hmhi588hmhi-588
    • 2020-11-04
    134 min

    [GVH-142]Pussy Device BondageXVII: Steel Ties, Pussy Bondage - Natsuho Imai

  • natsuho imai censoreddeepthroatsingle workGVHglory questGVH-142GVH14213gvh00142
    • 2020-11-05
    149 min

    [EKDV-647]Big Tits, Beautiful Legs, Super Small Waist! Super Model Beauty Is Actually A Super-Submissive Creampie Lover! "I Want A Marathon Fuck!" Maron Natsuki

  • marin natsuki censoredcreampiebig titsEKDVcrystal eizoumori no kuma taroue kissEKDV-647EKDV64749ekdv00647
    • 2020-11-06
    124 min

    [SSNI-905]The Married Woman Next Door Moved In And Now I've Been Deluged With Orgasmic Sex Minami Kojima

  • minami kojima censoredslutsingle workSSNIs1 no 1 stylebieber gonzoSSNI-905SSNI905ssni00905
    • 2020-11-15
    76 min

    300NTK-468 Erotic champion-class exquisite body beauty OL! !! Approval desire Egg Egg’s harsh heart & breasts are also stimulated and Gachi wet SEX is also taken! !! Kickboxing-polished tightening World-class good Ma ○ Ko with no gloves Chi

  • amateur censoredcreampieamateurntkntk-468ntk468300ntk-468
    • 2020-11-16
    39 min

    FC2PPV 1566507 [Personal shooting] [No] First shot compensated dating girl! The second! A shy girl with 170cm bristles and her pussy hidden! With purchase privilege [High-quality version ZIP, blowjob and masturbation (35 minutes)]

  • amateur uncensoredfc2
    • 2020-11-17
    129 min

    [JMTY-039]Free Pussy File 05 - 24-Year-Old Runa - Record Of A Hot Model Fuckbuddy D***king Cum And Taking A Creampie

  • censoredcreampieamateurJMTYteacher delusion groupukyo lifeJMTY-039JMTY039jmty00039
    • 2020-11-22
    116 min

    [HND-914]Married Woman With Infertile Husband Holes Up In Abandoned House For 30 Days To Enjoy Getting Filled Up With Thick Fertile Cum By Single Men - Yuri

  • censoredcreampiebig titsHNDhon nakahiroaHND-914HND914hnd00914
    • 2020-11-26
    52 min

    FC2PPV 1584472 [Appearance] [Uncensored] * Celebration first shot ☆ Luxury review privilege * Original neat and clean Bitch who gets wet with just a kiss 22 years old Yuzu Continuously live with SEX during life ♡

  • amateur uncensoredfc2
    • 2020-11-28
    88 min

    [IKST-006]Outstanding Amateur - Easily Seduced Pretty Girl, Naughty Guy, Big Soft Tits

  • censoredbig titsmarried womanIKSTsuddenly eroticIKST-006IKST006h-1454ikst00006
    • 2020-11-28
    159 min

    [JUFE-231]Snake Tongue Titty Fuck Servant Training Droopy Tits Finding Out A Hostess Princess' Weakness, We Fuck At A Hotel Honoka Tsujii

  • tsujii honoka censoredcreampiebig titsJUFEfitchJUFE-231JUFE231jufe00231
    • 2020-12-05
    54 min

    FC2PPV 1588931 [Personal shooting] First shot! Minami 22-year-old shaved slender beauty ★ Aviation-related office lady takes SEX for the first time in her life! Of course I will vaginal cum shot raw!

  • amateur uncensoredfc2
    • 2020-12-27
    149 min

    [FONE-128]10 Liters Of Squirting! My House Is Gonna Wash Away! Bratty Little Runaway Girl Splatters Older Guy's Entire Face With Pussy Juice And He Catches The Whole Thing On Camera - Fuka - Footage By: Single Male Sub (Age 39)

  • censoredcreampiesquirtingFONEfirst starplus first starFONE-128FONE128h-491fone00128
    • 2021-01-01
    43 min

    [opcyn-136]えま(19)

  • amateur censoredcreampieamateuropcynopcyn-136opcyn136opcyn-136
    • 2021-01-01
    158 min

    [TSF-011]College Guy Wakes Up As A Girl (20) - Normally He Loves Comics For Girls, Now It's His Turn To Get Fucked As A Woman Jin Ichinose

  • ichinose jun censoredcreampiebig titsTSFkaguyahimept mousouzokugynecomastia reportTSF-011TSF011tsf00011
    • 2021-01-21
    52 min

    FC2PPV 1653817 [Individual shooting] No51 Moe-chan, 18 years old, a super S-class beautiful girl is ashamed …

  • amateur uncensoredfc2
    • 2021-01-23
    143 min

    [JUL-441]She Might Be A Cougar, But She's Still Cute - She Might Be Cute, But She's Still Nasty. Natural Succubus, Man-Eating MILF Marika Kobayashi, Age 46, Makes Her Porn Debut!

  • marika kobayashi censoredmature womansingle workJULmadonnamametaro mamezawaJUL-441JUL441jul00441
    • 2021-01-23
    169 min

    [JUKF-055]My Stepbro Is My Masturbation Pet Natsu-Chan Natsu Tojo

  • natsu tojo censoredcreampieschoolgirlJUKFjumpjump avJUKF-055JUKF055h-227jukf00055
    • 2021-02-04
    148 min

    [SHIND-001]粘着ストーカーMの電車痴●・自宅侵入記録＃1・2

  • censoredamateurSHINDshinkirousuzuki o maSHIND-001SHIND001h-1560shind00001
    • 2021-02-06
    99 min

    [SHKD-927]Rin Didn't Do Anything Wrong, So Why Are You Taking It Out On Her Body？ Rin Kira

  • kira rin censoreduniformschoolgirlSHKDattackerssayaka datesharkSHKD-927SHKD927shkd00927
    • 2021-02-13
    69 min

    FC2PPV 1683892 [Two big tits amateurs] First shot double G cup! Former virgin kun’s first fucking experience, ekiben All-you-can-eat, soft body and naughty so you can put it inside firmly! First public release just before entering the warehouse

  • amateur uncensoredfc2
    • 2021-03-13
    118 min

    [MEYD-663]NTR While Taking Shelter From The Rain I Was Listening To This Housewife Complain About Her Husband When We Got Caught In A Sudden Rainstorm We Took Shelter In My Apartment, And Then, This Married Woman (Whom I Work With At My Part-Time Job

  • ai mukai censoredcreampiesingle workMEYDtameike gorokazumaMEYD-663MEYD663meyd00663
    • 2021-03-14
    51 min

    492MERC-255 Smaller Than Small Tits 2

  • amateur censoredsquirtinguniformmercmerc-255merc255492merc-255
    • 2021-03-16
    60 min

    300NTK-536 [10 head and body brown half beauty! !! 3 Squeezing SEX] Ichacola’s best older killer’s finest BODY half beauty! !! Boyfriend attacking with rich Echiechi service Gachi erection Ji ○ port rolls up! !! A super model style that loo

  • amateur censoredcreampieamateurntkntk-536ntk536300ntk-536
    • 2021-03-29
    59 min

    492JCHA-062 Semen of a stranger

  • amateur censoredbig titsuniformjchajcha-062jcha062492jcha-062
    • 2021-04-09
    213 min

    [BAZX-284]Thick Sex With A Widow In Mourning Dress vol. 003

  • censoredcreampieBAZXbazookatodoBAZX-284BAZX284bazx00284
    • 2021-04-10
    118 min

    [BAHP-073]Trying To Get Pregnant Porn "I Just Want A Baby!" 21 Year Old Woman Orgasms With Joy As Her Pussy Is Filled With Cum

  • censoredcreampieBAHPbaltandaibutsu yoshidahoppinBAHP-073BAHP073bahp00073
    • 2021-04-13
    82 min

    FC2PPV 1766790 Prefectural ③ Friends leaked-Limited quantity-

  • amateur uncensoredfc2
    • 2021-04-26
    39 min

    FC2PPV 1787250 [Complete appearance Hana-chan return work] Welcome back Hana-chan! Suddenly after returning, the first intercrural sex & vaginal cum shot H in my life! Even after vaginal cum shot, sperm is licked with a smile

  • amateur uncensoredfc2
    • 2021-04-27
    43 min

    490FAN-051 Yui 2

  • amateur censoredamateurbukkakefanfan-051fan051490fan-051
    • 2021-05-01
    130 min

    [JUL-561]Caught Outside In A Rainstorm, We Accidentally Enter A Love Hotel Rather Than A Business Hotel... Kana Mito

  • kana mito censoredmature womansingle workJULmadonnajotaro tomiJUL-561JUL561jul00561
    • 2021-05-03
    71 min

    FC2PPV 1800271 [3980 → Limited number 1980] Miraculous reunion after 2 months ❤️ Last Gonzo with my husband’s acquaintance Barre ❤️ Super permanent preservation version that I do not know when it will stop ❤️ A large amount of other people’

  • amateur uncensoredfc2
    • 2021-05-04
    135 min

    [KIRE-037]He Could Feel Her Rectal Vibrations All The Way Down His Cock A Big Ass Slut Sports Trainer Who Can Suck The Life Out Of Any Man With Her Exquisite Hips Sumire Kurusu

  • sumire kurusu censoredcreampieblowjobKIREsod createsiberia sakaibeauty kirei sodKIRE-037KIRE0371kire00037
    • 2021-05-06
    98 min

    435MFC-104 [JD of the body that fulfills all the desires of a man] Dense vaginal cum shot play with "Sena" of an exceptional super-dimensional erotic body! Roll up that and this with your proud H cup boobs! [Shiroto Gonzo ＃ Sena ＃ 20 years ol

  • amateur censoredcreampiebig titsmfcmfc-104mfc104435mfc-104
    • 2021-06-04
    86 min

    [393OTIM-077]【妄想主観】汁まみれ相部屋ホテルで孕ませ懇願不倫SEX もなみ鈴

  • amateur censoredcreampiemarried womanotimotim-077otim077393otim-077
    • 2021-06-08
    119 min

    [ARM-985]Girls Spread Their Pussies And Assholes! Beautiful Young Dirty Talking Girl

  • tsubaki rika mitsuha higuchi censoredslutARMaroma planningkijin kasaiaromaARM-985ARM985arm00985
    • 2021-06-10
    233 min

    [NHDTB-538]Busty Woman Living Alone Takes Sedatives And Does All-You-Can-Fuck With An Intruder In Her Home

  • censoredcreampieNHDTBnatural highvanilla sakuraiNHDTB-538NHDTB5381nhdtb00538
    • 2021-07-04
    65 min

    SIRO-4567 [First shot] [Active nice ass JD] [Obedient service] A maid cafe clerk of an active university student participates in the war. She dyes her cute face with pleasure and panting lewdly .. Application amateur, her first AV shooting 217

  • amateur censoredamateursirosiro-4567siro4567siro-4567
    • 2021-07-09
    63 min

    SIRO-4549 [First shot] [Swaying G milk] [Sensitive literary girl] Sensitive shy girl with weak nipples. She has little sexual experience, but the appearance that she feels in agony is the most erotic, desperately shaking G big tits .. AV application

  • amateur censoredbig titsamateursirosiro-4549siro4549siro-4549
    • 2021-07-10
    122 min

    [AUKG-517]Fifty-something Lesbians - Afternoon Secret Lustful Meeting In A Love Hotel - Chisato Shoda Mio Saionji

  • shota chisato mio saizonoji censoredbig titslesbianAUKGu krentoAUKG-517AUKG517aukg00517
    • 2021-07-31
    132 min

    FC2PPV 1948352 I secretly removed the rubber on the way to a loli bristle slender with one experienced person and made a vaginal cum shot, a stunned expression. & 19-year-old G cup fair-skinned beautiful breasts JD is thrust at her first raw cock

  • amateur uncensoredfc2
    • 2021-08-03
    41 min

    1Pondo 080321_001 Piledriver BJ, Special Edition 17 Kanna Kitayama An Himukai Asuka Motomiya

  • amateur uncensored1pondo



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download