hikari yui




FC2BBANAUKGSSISVENXLULUVEMAATIDCJODNGODSHKDHODVGVHMIDEPPPDMIDVNACRMEYDMARASSNIHDKA

2020-12-04
50 min

[TOTTE-011]Aya At 30 Her 4th Year Of Marriage

  • censoredcreampiebig titsTOTTEsadistic villagemagic mirror sadistic villageTOTTE-011TOTTE0111totte00011
    • 2020-12-10
    45 min

    H4610 ki201210 Yuka Sugino 25years old

  • amateur uncensoredh4610
    • 2020-12-19
    80 min

    [sqb-079]さきほ

  • amateur censoredamateurbeautiful girlsqbsqb-079sqb079sqb-079
    • 2020-12-21
    120 min

    [TTTV-001]One Stormy Night, I Was Trapped At The Office With My Lady Boss Reiko Kobayakawa

  • kobayakawa reiko censoredbig titsmature womanTTTVglobal media annexkikuji akabanetentativeTTTV-001TTTV001tttv00001
    • 2020-12-21
    126 min

    [GENM-065]This Massage Parlor Slut Made Me Ejaculate Using Her Amazing Techniques Amy Fukada

  • emi fukada censoredsluthandjobGENMgenekifukadaGENM-065GENM065genm00065
    • 2021-01-01
    120 min

    [AWD-121]My Stepmom's Perfect Ass - My Stepmom's Got A Beautiful, Super Sensitive Booty Miya Tanaka

  • miya tanaka censoredbig titsmarried womanAWDrubysusumu yanoguchinext doorAWD-121AWD121awd00121
    • 2021-01-06
    53 min

    [sika-002]あみ＆りか

  • amateur censoredcreampieuniformsikasika-002sika002sika-002
    • 2021-01-07
    168 min

    [MADV-502]My Gamer Buddy Was A S********l, So I Invited Her To My Place And Made Her Fuck Me.

  • natsuki kisaragi momoka arisu censoredcreampieuniformMADVcrystal eizoharuo miyafujimaniac crystalMADV-502MADV50249madv00502
    • 2021-01-08
    57 min

    10musume 010821_01 Breast cancer awareness survey questionnaire ended up for a vaginal cum shot Chinatsu

  • amateur uncensored10musume
    • 2021-01-23
    69 min

    FC2PPV 1656680 [Clothing sexual intercourse] Girls are the cutest and most erotic in uniforms! After all, it’s awesome to not take them off. Gonzo with a honey girl who is only cool raw!

  • amateur uncensoredfc2
    • 2021-01-28
    485 min

    [MGHT-281]I Fell In Love With My Wife`s Mother And Fucked Her.

  • censoredstepmomMGHTtakara videotakaraMGHT-281MGHT28118mght00281
    • 2021-01-31
    182 min

    [SQIS-042]Ravished - Sacrificed To Monstrous Lust

  • censoredbig titsmature womanSQISfa proSQIS-042SQIS042sqis00042
    • 2021-02-03
    54 min

    FC2PPV 1671179 Limited time [Uncensored] Supporting a big tits cafe manager, continuous vaginal cum shot

  • amateur uncensoredfc2
    • 2021-02-07
    59 min

    HEYZO 2454 Busty Married Wife’s Affair Vol.2 – Madoka Ayakawa

  • madoka ayakawa uncensoredcreampieheyzo
    • 2021-02-12
    117 min

    [MUKC-015]A Famous Cosplayer's Cosplay Sex - Eimi Fukada

  • emi fukada censoredcreampiecosplayMUKCmukuinnocent cosplayMUKC-015MUKC015mukc00015
    • 2021-02-12
    270 min

    [DNW-110]No More Daddy Issues! [Tricking An Insolent Daughter To Eat Her Pussy] 04

  • censoredcreampiebig titsDNWprestigedocumentDNW-110DNW110118dnw00110
    • 2021-02-15
    17 min

    FC2PPV 1687749 1200pt → 599pt Super super beautiful! A very rare beautiful girl, a 19-year-old beautiful girl, keeps watching the phone while having sex with her boyfriend! This is the most beautiful girl I have ever seen! Please download as soon as

  • amateur uncensoredfc2
    • 2021-02-18
    147 min

    [SSIS-001]After Abstaining From Sex For A Month, I Lost My Mind Having Nothing But Infidelity Sex With My Girlfriend's 2 Roommates While She Was Away For 3 Days. Tsukasa Aoi Sayaka Otoshiro

  • tsukasa aoi otoshiro sayaka censoredbeautiful girldramaSSISs1 no 1 styleichigoharaSSIS-001SSIS001ssis00001
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-03-08
    54 min

    FC2PPV 1716939 [No] [Large and very popular! !! Thanks final discount 100 pieces limited 3980pt → 2480pt] Yes 〇 Purely similar beauty ♥ ️ The most beautiful girl in the past First Gonzo ♥ ️ Massive vaginal cum shot! !! ♥ ️ ※ Review privilege / Suctio

  • amateur uncensoredfc2
    • 2021-03-11
    132 min

    [GUN-749]Vibrator Masturbation With Super Small Swimsuits

  • aki erie arai erie yuka osawa rumi tadami censoredsquirtingGUNradixshio sakurabaexceptionalGUN-749GUN749433gun00749
    • 2021-03-19
    120 min

    [SYKH-023]Dick Sucking Wife She Looks Sweet On The Outside But Is Actually A Complete Slut Miss Sara 35 Years Old

  • censoredcreampiemature womanSYKHleisurely missus emmanuelleSYKH-023SYKH023sykh00023
    • 2021-03-26
    55 min

    [pvmk-009]まこ(23)

  • amateur censoredamateurpvmkpvmk-009pvmk009pvmk-009
    • 2021-03-27
    244 min

    [KTKC-110]My Year With A Devilish Amateur With Big K-Cup Tits 7 Videos 4 Hours

  • censoredbig titsamateurKTKCkittyx delusion tribebeef lewd ganovbig titsKTKC-110KTKC110ktkc00110
    • 2021-03-27
    160 min

    [LULU-062]My Boss Is A Married Woman And Former Punk Girl With Big Tits! She Loves Taking Advantage Of Her Male Employees' Dicks Chitose Yuki

  • chitose in the evening censoredcreampiebig titsLULUlunaticsluminaxLULU-062LULU062lulu00062
    • 2021-04-09
    42 min

    FC2PPV 1761757 Infiltrate a secret orgy ㉙ The girl who is going to participate is slapstick on the day (> _ <) That child comes up like a savior in front of the disappointed Osans! 10 consecutive vaginal cum shots! !! * High-quality version &

  • amateur uncensoredfc2
    • 2021-04-10
    118 min

    [BAHP-073]Trying To Get Pregnant Porn "I Just Want A Baby!" 21 Year Old Woman Orgasms With Joy As Her Pussy Is Filled With Cum

  • censoredcreampieBAHPbaltandaibutsu yoshidahoppinBAHP-073BAHP073bahp00073
    • 2021-04-16
    38 min

    FC2PPV 1772933 Realistic GoPro video + iPhone high quality Ver ❤️ Hirosue ● Call the legendary "Pukuman" Kanon on holidays and take a daytime affair Icha Koi Gonzo ❤️ Many purchase benefits

  • amateur uncensoredfc2
    • 2021-04-20
    86 min

    [DMAT-192]While This Stepmom Rests Her Stepson Paid Her A Night Visit

  • censoredcreampielingerieDMATstar paradisedamatenDMAT-192DMAT192h-254dmat00192
    • 2021-04-28
    16 min

    FC2PPV 1767791 [Personal shooting] Maria 27 years old short SEX remastered version [for a limited time]

  • amateur uncensoredfc2
    • 2021-05-04
    140 min

    [STARS-377]My G-Spot Is In My Titties ... The Sensual Nipples And Titties Of A Beautiful Girl Who Can Cum Just With Her Boobs Himari Asada

  • himari asada censoredbig titsbeautiful girlSTARSsod creategoemonsod starSTARS-377STARS3771stars00377
    • 2021-05-07
    135 min

    [HODV-21570]This Horny Hospitality Whore Will Provide You With Extra Special Service And She'll Use Her Slender Body And H-Cup Titties To Treat You Like A God And Bring You To Full Course Ejaculatory Pleasure Miyabi Midorikawa

  • midorikawa miyabi censoredbig titshandjobHODVh m pk c takedaHODV-21570HODV215705642hodv21570
    • 2021-05-11
    136 min

    [STARS-373]Breaking In Her Teacher: "Do You Like To Have Your Nipples Teased, Teacher？" My S*****t Kaede Whispered In My Ear While She Stroked My Nipples. Kaede Hiiragi

  • hiiragi kaede censoredbeautiful girlsingle workSTARSsod createkisshisod starSTARS-373STARS3731stars00373
    • 2021-05-14
    240 min

    [HUNTB-013]I'm Together With My C***dhood Friend, And We're Playing A Private Game Of Truth Or Dare! We Always Liked Each Other, But Because We Were Always Together, We Could Never Tell Each Other That, And So We Continued With This Weird Rel

  • censoredschoolgirlHUNTBhunterkawajirihhh groupHUNTB-013HUNTB013huntb00013
    • 2021-05-24
    20 min

    FC2PPV 1833619 Naked and charmed with a full-length no-hand blow job! The strongest fetish of the cute and small devil long tongue, God Tech Airi-chan! A large amount of semen is fired in the mouth and muddy reverse to the dick w

  • amateur uncensoredfc2
    • 2021-06-03
    66 min

    FCP-021 [Delivery only] It feels better than insertion … Completely subjective! Raw Ma ● Co Intercrural Sex! !!

  • amateur censoredbig titsamateurfcpfcp-021fcp021fcp-021
    • 2021-06-24
    73 min

    200GANA-2515 Seriously Nampa, first shot. 1652 Bring the gal JD on the way back from the hairdressing shop to the hotel as an interview! Pretending to be drunk and trying to do something sexually harassing …？ The fair-skinned body and smooth but

  • amateur censoredsquirtingamateurganagana-2515gana2515200gana-2515
    • 2021-07-05
    65 min

    493NAEN-068 None! ？？ Idol class Lori beautiful girl! ？？ Rin Kira throwing a big cock into 148 32

  • amateur censoredamateurbeautiful girlnaennaen-068naen068493naen-068
    • 2021-07-14
    65 min

    FC2PPV 1921054 [Complete Amateur 113] Con 19 Years Old Part 2, Complete Appearance, Popular S-class Beautiful Girl Clothes Bondage Sex!

  • amateur uncensoredfc2
    • 2021-07-14
    132 min

    [HUNTB-054]2 Minutes After Things Get Started, This Slick And Slippery Braless Girl (In A See-Thru Outfit And Known To Be A Hot And Erotic Good Time) Will Tease And Tweak Your Cock And Nipples With An Oil Massage At This Underground Men's Massage

  • censoredHUNTBhuntermasanorihhh groupHUNTB-054HUNTB054huntb00054
    • 2021-07-20
    240 min

    [MGDN-157]MILF Just Can't Say No To Fucking And Sucking Dicks - 4 Hours Of Pleasure

  • eiko kirishima erika sawaki censoredmarried womanmature womanMGDNstar paradisemegadonMGDN-157MGDN157h-254mgdn00157
    • 2021-08-02
    82 min

    259LUXU-1456 Luxury TV 1438 A Perverted Tutor Who Makes Students Saffle Appears! Excited By The Sense Of Immorality Of "Not Cool", Seduce Students To Take A Step-By-Step Sex Education! I Wasn’T Satisfied With That Alone And Applied For L

  • amateur censoredbig titsamateurluxuluxu-1456luxu1456259luxu-1456
    • 2021-08-06
    58 min

    FC2PPV 1962283 [Uncensored] Metropolitan Nursing / Gonzo 19 Years Old: Nursing Student

  • amateur uncensoredfc2
    • 2021-08-21
    76 min

    FC2PPV 2056471 * Limited Time Price & Limited Bonus [Teacher License Deprivation] At The End Of School, Look For A Man With An App Dirty Talk Barrage Big Ass Cowgirl Dimension Stop Slut Play & Demon Egg Piston Conceived Gachi Acme Fuckin !! [Ad

  • amateur uncensoredfc2
    • 2021-09-17
    74 min

    529STCV-014 Mikako-Chan (18)

  • amateur censoredcreampieschoolgirlstcvstcv-014stcv014529stcv-014
    • 2021-09-24
    205 min

    [HUNTB-098]A Bunch Of Easy Girls From School Made Me Participate In Their Pov Porn As Part Of The Yearbook. We Went All Over School Recording Ourselves Fucking, With Me In The Starring Role As The One With A Dick.

  • censoredcreampieschoolgirlHUNTBhunterkoichi davidsonhhh groupHUNTB-098HUNTB098huntb00098
    • 2021-09-29
    65 min

    491TKWA-189 H Cup Big Tits J ● And Uniform Creampie Raw Saddle! (Riho Takahashi)

  • amateur censoredcreampiebig titstkwatkwa-189tkwa189491tkwa-189
    • 2021-10-19
    60 min

    H4610 ki211019 Chisato Kaneko 26years old

  • amateur uncensoredh4610



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download