eri takikawa misato arisawa




FC2ABWHNDJUFEHDKASSNIJULAVSAADNMIDESPRDWAAAMEYDCHRVSDABVENXGMEMSANNGODKSBJVEMA

2020-09-22
140 min

[KIRE-003]A Crazy Masochistic Married Woman Working At A Major Apparel Maker Megemi Fuji 31 Years Old, AV DEBUT

  • megumi ando censoredmature womandeepthroatKIREsod createsuisei akaibeauty kirei sodKIRE-003KIRE0031kire00003
    • 2020-09-24
    17 min

    10musume 092420_01 Secret Pussy Collection: Sumire Kamogawa

  • amateur uncensored10musume
    • 2020-09-25
    482 min

    [DPEC-012]Beautiful Tits, Stunning Ass, Breathtaking Bodies. The Most Gorgeous Girls In The Whole Country - Mature Women With K**ler Curves , All Creampie Sex 40 Girls, 8 Hours

  • censoredmature womanDPECdynamite enterprisedynamite platinumDPEC-012DPEC012h-1386dpec00012
    • 2020-10-01
    70 min

    [ZOZO-019]Shame! A Young Boys And Girls Mixed Naked Bodies Strength Test 2020 4 Ab Strength Tests - A Battle-Style Pussy Pressure Test - Female Reproductive Strength Tests 2

  • censoredZOZOsadistic villageZOZO-019ZOZO0191zozo00019
    • 2020-10-17
    477 min

    [OFJE-279]Rara Anzai 1st BEST Collection

  • anzai rara censoredbig titsbeautiful girlOFJEs1 no 1 styleOFJE-279OFJE279ofje00279
    • 2020-10-24
    120 min

    [JUL-357]Amazing Lover Who You Get Used To The More You Hold Her Dark Skinned Blonde Beauty Kurumi Age 30

  • censoredmature womanJULmadonnano directorJUL-357JUL357jul00357
    • 2020-10-31
    99 min

    300MAAN-594 [Hmm! I can’t stop fainting in agony! 3 consecutive vaginal cum shot in convulsions! !! ] Fair-skinned exquisite BODY that makes you want to spear in seconds! Violently sucking fixed vibes swell violently! Devil piston in a situation

  • amateur censoredcreampieamateurmaanmaan-594maan594300maan-594
    • 2020-11-13
    200 min

    [MDBK-142]Submissive Private Tutor With Big Tits Can't Say No To Her S*****t Asking For Sex After Getting 100 On His Test, Gets Creampie

  • nene tanaka yuri fukada censoredcreampiebig titsMDBKbazookashizukamanMDBK-142MDBK142h-1496mdbk00142
    • 2020-11-26
    163 min

    [NHDTB-463]Picked Up In Pantyhose - Master Groper Finger-Bangs A S********l Until Her Beautiful Legs Shake And She Cums So Hard She Squirts

  • censoredsquirtingschoolgirlNHDTBnatural highkansukeNHDTB-463NHDTB4631nhdtb00463
    • 2020-12-11
    42 min

    359TYVM-112 Erika

  • amateur censoredcreampiemarried womantyvmtyvm-112tyvm112359tyvm-112
    • 2020-12-12
    149 min

    [DASD-777]She's Made Up Her Mind - Famous Pro Guitarist's Porn Debut! Natsuki Mizuno

  • mizuno nagisa censoredsquirtingbeautiful girlDASDdasinaballDASD-777DASD777dasd00777
    • 2020-12-15
    197 min

    [PYM-360]Cock-Crazed Extreme Orgasms, Hard Piston Dildo Masturbation

  • censoredPYMprimoPYM-360PYM360h-283pym00360
    • 2020-12-24
    302 min

    [SVOMN-150]Squirting Even Though They're Ravished - 100 Girls Made To Cum! 5 Hour Compilation

  • censoredcreampiesquirtingSVOMNsadistic villageSVOMN-150SVOMN1501svomn00150
    • 2020-12-27
    59 min

    HEYZO 2425 Horny Married Woman Wants To Have Sex — – Ryu Enami

  • ryu enami uncensoredcreampieheyzo
    • 2021-01-12
    140 min

    [STARS-320]Sweatily Licking And Kissing The Body Of A Beautiful Girl - Mei Miyajima

  • mei miyajima censoreduniformhandjobSTARSsod creategoemonsod starSTARS-320STARS3201stars00320
    • 2021-01-17
    48 min

    HEYZO 2442 Wanna Be Fucked By Amateur Nympho MILF! Vol.3 – Natsuki Kikuta

  • natsuki kikuta uncensoredcreampiehandjobheyzo
    • 2021-01-17
    122 min

    [BBTU-004]Titty Fuck Mama Slutty Mama With Big Tits Who Will Milk Any Dick Nao Nakano

  • nanao nakano censoredbig titssquirtingBBTUdogmatenunmy big titsBBTU-004BBTU004bbtu00004
    • 2021-02-04
    86 min

    [AKDL-081]Sudden Reversal - Irritated Babe Wants To Suck Your Dick Now？! Shocking Dual Blowjob

  • i m in sakino honoka wakamiya censoredbig titsslutAKDLaquinorifsetaknrAKDL-081AKDL0811akdl00081
    • 2021-02-23
    45 min

    FC2PPV 1698778 ☆ Half-price opening campaign ☆ Outdoors! Reverse offer from a frustrated lewd beautiful mature woman! Creampie SEX while enjoying a feeling of openness!

  • amateur uncensoredfc2
    • 2021-03-13
    60 min

    HEYZO 2478 Deep Kiss, Furious Sex -Make Me Wet- – Miyu Morita

  • miyu morita uncensoredcreampieheyzo
    • 2021-03-15
    76 min

    FC2PPV 1711124 [G cup slime milk] I will expose private SEX with a big tits big butt gal w Blow with an erotic tongue with an open tongue is the best! Geki Yabahame shooting video that pierces from the top to the bottom and shakes the huge breasts

  • amateur uncensoredfc2
    • 2021-03-27
    150 min

    [DBER-106]The Hidden Truth Of Angry Women Views Of The Intense Peaks Of Pleasure In Between Heaven And Hell H

  • censoredbdsmDBERbabyentertainmentred babeDBER-106DBER106dber00106
    • 2021-04-02
    56 min

    [NTTR-061]Possessed S********l Runaway! She Never Thought She'd Sell Her Body Quite Like This! Her Sweet Young Body, Used By Horny Adults... Shizuku Asahi

  • asahi drop censoredcreampiebeautiful girlNTTRsod createbijutsu takatakeoverNTTR-061NTTR0611nttr00061
    • 2021-04-02
    265 min

    [HEZ-264]Beautiful Cheaters - Picking Up Married Sluts For Adultery-For-Cash - Ms Keiko / Ms Mitsuyo / Ms Anri

  • censoredmature womanHEZhot entertainmentHEZ-264HEZ26459hez00264
    • 2021-04-09
    260 min

    [SKMJ-159]This Horny Married Bitch Is Excessively Sexy And Downright Rude And Crude And Is Giving Me An Amazing Cowgirl For My First Cherry Boy Sex!! "Is This Really Your First Time (Hearts)？ You're So Cute (LOL)" 16 Fucks To Pop A Cherry

  • censoredcreampiebig titsSKMJblush girlSKMJ-159SKMJ159h-1324skmj00159
    • 2021-04-14
    119 min

    [OKSN-330]New Discovery! Naturally Tanned Beauty With Incredible Curves! Her Lust Is Off The Charts - She'll Want You To Breed Her Every Chance She Gets

  • censoredbig titsOKSNabc mousouzokuokaasan.com abc daydream familyOKSN-330OKSN330oksn00330
    • 2021-04-17
    136 min

    [JUL-539]I Can Never Tell My Wife That I Knocked Up My Mother-In-Law... I Lost Control And Gave Her My Creampie On Our One Night, Two-Day Hot Spring Vacation. Maiko Ayase

  • maiko ayase maria sawaguchi censoredcreampiemature womanJULmadonnaunicorn fukudaJUL-539JUL539jul00539
    • 2021-05-05
    61 min

    [050521_001]穴親子

  • amateur uncensored1pondo
    • 2021-05-14
    224 min

    [HUNTB-011]Extremely And Excessively Erotic! I Had The Great Luck To Be There While She Thrust Her Big Ass Out At Me, But Now I Could No Longer Resist This Temptation! I Lost My Mind And Plunged My Cock Inside And Now This Beautiful Lady Was Excited

  • censoredcreampieHUNTBhunterkiteretsuhhh groupHUNTB-011HUNTB011huntb00011
    • 2021-06-11
    140 min

    [JUFE-298]My Mom Got Remarried So Now I Have A New Stepfather, And I Hate His Guts, But He Keeps On Going Behind Her Back And Licking And Fucking Me Over And Over Again Until I Have Lost All Hope ... Mei Satsuki

  • satsuki mei censoredschoolgirldeepthroatJUFEfitchJUFE-298JUFE298jufe00298
    • 2021-06-15
    128 min

    [KTRA-302]Horny Stepsister Wants Her Stepbrother - Creampie Temptation Urara Kanon

  • hanaoto urara censoredcreampieschoolgirlKTRAk tribeKTRA-302KTRA302h-094ktra00302
    • 2021-06-15
    125 min

    [STARS-385]Younger Sister Seduces Her Older Sister's Husband With Hot And Steamy Tongue Kissing Three Day Holiday Spent At Home Kissing And Having Sweaty Sex Kaede Hiiragi

  • hiiragi kaede censoredbeautiful girlslutSTARSsod createdragon nishikawasod starSTARS-385STARS3851stars00385
    • 2021-06-23
    65 min

    404DHT-0205 Sakamoto ○ Enjoy the beautiful big tits of a similar forty mature woman! Yuriko 48 years old

  • amateur censoredbig titsmarried womandhtdht-0205dht0205404dht-0205
    • 2021-06-24
    118 min

    [MILK-112]I Love Older Men I'll Cover You In Sloppy Wet Kisses Coed Slut Mao Watanabe

  • mao watanabe censoreduniformschoolgirlMILKmilkMILK-112MILK112h-1240milk00112
    • 2021-06-26
    160 min

    [LULU-081]"I Wanna Try Anal But I Don't Want My Boyfriend To Think I'm A Freak..." It'll Be A Secret Between Just The Two Of You, An Anal Fuck With Your C***dhood Friend. Mirei Niita

  • mirei nitta censoredanalcreampieLULUlunaticsluminaxLULU-081LULU081lulu00081
    • 2021-07-10
    115 min

    [DPMI-060]Race Queen Lovers Honoka Kimura

  • honoka kimura censoredsingle workDPMImiludopamixDPMI-060DPMI060dpmi00060
    • 2021-07-22
    74 min

    FC2PPV 1935465 [Complete Amateur 114] Jd Ako 20 Years Old, Loss Of Genuine Virginity, Premium 4k

  • amateur uncensoredfc2
    • 2021-07-23
    33 min

    HEYZO 2589 She Has Flexible Tits & Responsive Clit – Chisa

  • chisa uncensoredheyzo
    • 2021-07-30
    62 min

    FC2PPV 1947772 [First Shot] Two Consecutive Vaginal Cum Shots To The 43-Year-Old Principal Who Is Too Beautiful ☆ "I Am A Director At A School Corporation" ☆ The Principal Of A Kindergarten Licks Anal + Standing Back In The Bath [Personal Sho

  • amateur uncensoredfc2
    • 2021-08-06
    174 min

    [JUNY-041]This Perky J-Cup"s Always Wearing A Smile And She"ll Stun You With Her Dazzling Gaze! In These Troubled Economic Times, She Can"t Seem To Hold Down A Job... So This Formed Synchronized Swimmer College Girl With Colossal Tits And

  • censoredbig titsJUNYfitchnikuyokuJUNY-041JUNY041juny00041
    • 2021-08-06
    64 min

    10musume 080621_01 I’M Embarrassed But I Feel Good: If You Touch My Body So Much, I’Ll Get Wet! Ryoko Kobayashi

  • amateur uncensored10musume
    • 2021-08-07
    125 min

    [REAL-774]"I"m Going To Send You Straight Down To Sweet Hell" A Sweetly Sadistic Beautiful Girl Is Explosively Sucking Out Boys" Semen Until They Go Insane! Endless Insanity And Sweet And Squishy Pussy-Pounding Sex! Hana Shirato

  • white peach censoredcreampieblowjobREALk m producesamoarireal real worksREAL-774REAL774real00774
    • 2021-08-11
    61 min

    230OREC-853 Airi

  • amateur censoredcreampieamateurorecorec-853orec853230orec-853
    • 2021-08-13
    225 min

    [HUNTB-083]When I Stayed At My Step-sibilings" House To Study, Their Clothes Are So Erotic That I Didn"t Know Where To Look!

  • censoredHUNTBhunterkoichi davidsonhhh groupHUNTB-083HUNTB083huntb00083
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-20
    78 min

    FC2PPV 2228391 Super Popular "Hatsumi Saki" Uncensored Raw Vaginal Cum Shot Outflow 16 / Silent Support ● Sober Daughter First Part (Uniform, Shaving, Shaved, Raw Vaginal Cum Shot, Cum Swallowing)

  • amateur uncensoredfc2
    • 2021-09-25
    119 min

    [CEMD-062]Lewd Anal Masturbator! Kayo Iwasawa -She Practically Loses Herself For Non-stop Anal Masturbation.

  • kayo iwasawa censoredanalbig titsCEMDserebu no tomoCEMD-062CEMD062cemd00062
    • 2021-09-27
    76 min

    259LUXU-1483 Luxury TV 1462 A Beauty Registered Dietitian Who Says He Lost Love Because Of His Affair Appeared. She Looks Nervous About Having Sex With The Man She Met For The First Time, But Her Body Reacts Sensitively As She Begins To Ripen As An A

  • amateur censoredamateurluxuluxu-1483luxu1483259luxu-1483



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download