beautiful kanon




FC2DTTMIDVAUKGBBANADNEBODDASDROYDHZGDSQTEABWNACRBLKSSNIMEYDATIDFSDSSCESDSSISSPRD

2020-12-05
120 min

[SHKD-915]I'll Never Forget The Man Who Ravished Me... Hijiri Maihara

  • kiyoshi maihara censoredSHKDattackerstakuo otanideath night evilSHKD-915SHKD915shkd00915
    • 2020-12-06
    140 min

    [PKPD-124]Pink-Nippled F-Cup Curvy Girl Shizuku Mihana - New Face Debut

  • mika shizuku censoredcreampiebig titsPKPDfuck group and fun friends daydreamersPKPD-124PKPD124pkpd00124
    • 2020-12-13
    104 min

    [BADA-009]Addicted To Adultery - Wife (28) Can't Slake Her Cheating Lust Yumina Hirosaki

  • yumina hirosaki censoredmarried womanblowjobBADAvartanyoshida great buddhadiamondBADA-009BADA009bada00009
    • 2020-12-19
    38 min

    [HHKL-078]"Hey, What Do You Think About This Underwear？ Does It Look Cute On Me？" My Plain Jane Big Stepsister Started Working For An Underwear Company, And As She Began To Start Wearing Sexy Underwear, She Gradually Became More Sexy And Erot

  • nene tanaka censoredcreampiebig titsHHKLhunterkonjac kanohhh groupHHKL-078HHKL078hhkl00078
    • 2020-12-26
    45 min

    [per-356]いつき 2

  • amateur censoredamateurblowjobperper-356per356per-356
    • 2021-01-01
    91 min

    [MMRAA-179]石田ふみ キミ、10代、恋の予感

  • ishida fumi censoredsoloworkMMRAAspice visualMMRAA-179MMRAA179
    • 2021-01-01
    237 min

    [FIV-074]Five-Star Channel - Taken Out For Secretly Filmed Sex - Big Tits Special Ch. 52 - Voyeur Footage Of Lively Amateur Girls' Totally Natural Reactions - 4 Hours!

  • censoredbig titsamateurFIVprestigefive starsFIV-074FIV074118fiv00074
    • 2021-01-21
    181 min

    [SW-752]Devilish Little Cutie With Big Tits And A Big Booty Awakens Her Inner Slut! Her Lover Turns The Tables On Her And Pounds Her With His Huge Cock!

  • censoredbig titsSWswitchyocchanswitch switchSW-752SW7521sw00752
    • 2021-01-23
    55 min

    383REIW-023 Ibu

  • amateur censoredcreampiebig titsreiwreiw-023reiw023383reiw-023
    • 2021-01-23
    156 min

    [CJOD-275]Ultra Sexy Dual Slut MILFs Beg For You To Cum Harder At Their Apartment-Turned-Brothel Yuri Honma Arisa Hanyu

  • really arisa hanyu arisu hanyu censoredcreampiebig titsCJODchijo heavenmametaro mamezawaCJOD-275CJOD275cjod00275
    • 2021-01-29
    65 min

    SIRO-4402 [First shot] [Marshmallow beautiful breasts] [Extremely erotic wife with an obscene ass] The extremely erotic wife developed by a former boyfriend can not be satisfied with her current husband .. She who swallows the semen of the man she me

  • amateur censoredmarried womanamateursirosiro-4402siro4402siro-4402
    • 2021-02-17
    50 min

    444KING-029 Hina

  • amateur censoredcreampiebig titskingking-029king029444king-029
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-27
    239 min

    [GAVHJ-033]Beautiful Married Women Get Picked Up! 6 - Sexually Frustrated Housewives Are Turned On And Ready To Fuck Raw! 10 Creampies! 4 Hours!

  • censoredcreampiebig titsGAVHJgraffiti japangati graffiti japanGAVHJ-033GAVHJ03348gavhj00033
    • 2021-03-16
    57 min

    345SIMM-622 Her Sister Is J ●… Licking And Taking A Voyeur Is A Big Failure! … But I was able to make vaginal cum shot twice

  • amateur censoredcreampieuniformsimmsimm-622simm622345simm-622
    • 2021-03-18
    118 min

    [PPPD-914]Making Babies Out Of Wedlock With Your Colossal-Titted I-Cup Lover Who Comes Hard For Your Creampie At A Hot Spring Hotel

  • censoredcreampiebig titsPPPDoppaiPPPD-914PPPD914pppd00914
    • 2021-03-25
    57 min

    230ORETD-856 Narumi

  • amateur censoredcreampieuniformoretdoretd-856oretd856230oretd-856
    • 2021-04-02
    174 min

    [SSIS-036]Exclusive NO.1 STYLE The Gravure Idol Kaoru Yasui Her S1 Debut

  • kaoru yasui censoredbig titssingle workSSISs1 no 1 stylemon cSSIS-036SSIS036ssis00036
    • 2021-04-03
    237 min

    [FAVKH-002]Real Married Amateur Makes Her Porn Debut While Shopping! 2

  • yuri sasahara makihara aina censoredcreampiesquirtingFAVKHariseFAVKH-002FAVKH002h-1577favkh00002
    • 2021-04-03
    140 min

    [PKPD-139]A Rubberless Pay-For-Play Sugar Daddy x A Sch**lgirl In Loose Socks In A Half-In/Half-Out Half-Day Of Fucking

  • suzuka walnut is it censoredcreampieuniformPKPDfuck group and fun friends daydreamersPKPD-139PKPD139pkpd00139
    • 2021-04-14
    148 min

    [SSIS-048]She Heard It Was Going To Be Photos Of Non-Nude Erotica, But This Pale-Skinned, Busty Beauty Was Fooled - This Was A Porn Shoot Real-Life Sexy Costume Non-Nude Erotica Akua Yamazaki

  • mizuyama yamazaki censoredbig titsbeautiful girlSSISs1 no 1 styleichigoharaSSIS-048SSIS048ssis00048
    • 2021-04-23
    178 min

    [MIFD-154]Fresh Face: 20-Year-Old New Hire At A Major Entertainment Company's Photo College In Swimsuits: Gorgeous G-Cup Model Makes Her Bikini Porn Debut! Kokona Asakura

  • asakura here censoredbig titsbeautiful girlMIFDmoodyzusa pyonmoodyz freshMIFD-154MIFD154mifd00154
    • 2021-05-07
    59 min

    230OREC-756 Yukino

  • amateur censoredcreampieamateurorecorec-756orec756230orec-756
    • 2021-05-09
    61 min

    HEYZO 2518 Pissing MILF Really Loves Anal Drilling – Mikako Tachibana

  • amateur uncensoredcreampieheyzo
    • 2021-05-14
    118 min

    [PPPD-927]My Girlfriend's Older Sister Seduced Me With Her Big Tits And Promise To Let Me Cum Inside Of Her Riho Fujimori

  • riho fujimori censoredcreampiebig titsPPPDoppaiPPPD-927PPPD927pppd00927
    • 2021-05-15
    82 min

    200GANA-2485 Seriously Nampa, first shot. 1636 Picking up a beautiful girl with a good style in Akihabara! When I was playing with electric massager, my body got hot, and I went to SEX! A stunned expression while panting … It’s all about me

  • amateur censoredbig titsamateurganagana-2485gana2485200gana-2485
    • 2021-05-20
    38 min

    FC2PPV 1827016 [Bonus delivery] Non-contraceptive 18-year-old student with a childish body ◯ This is the first vaginal cum shot in my life.

  • amateur uncensoredfc2
    • 2021-05-22
    242 min

    [XRL-008]Nympho Slut Deep Kissing And Raunchy Cock Sucking BEST

  • aki sasaki an sasakura censoreduniformblowjobXRLreal worksreal real worksXRL-008XRL008xrl00008
    • 2021-06-03
    263 min

    [SHIND-010]粘着ストーカーMの電車痴●・自宅侵入記録＃19・20

  • censoredSHINDmiragemirage mirageSHIND-010SHIND010h-1560shind00010
    • 2021-06-12
    119 min

    [AUKG-514]Denim Maniacs H

  • nagatsuki natsuki shizuka sugisaki censoredlesbianAUKGu krentoAUKG-514AUKG514aukg00514
    • 2021-06-14
    74 min

    328HMDN-372 Highest Peak H Cup Big Breasts Wife (27 Years Old) Nasty Cheating Wife Loves Handsome Dick. With a jubu wet raw pussy, let the cock crotch and make the milk fluffy and it is continuous! Massive ejaculation to an unequaled wife who invites

  • amateur censoredcreampiebig titshmdnhmdn-372hmdn372328hmdn-372
    • 2021-06-15
    81 min

    [PPMNB-108]Being Cute Is Not Enough! Natsuki

  • censoredbig titsbeautiful girlPPMNBcranePPMNB-108PPMNB108h-706ppmnb00108
    • 2021-06-20
    125 min

    [DVMT-004]S*****t Goes Creampie Job-Hunting Sana

  • censoredcreampiebig titsDVMTtoyohikotoyohikotoyohiko kikakuDVMT-004DVMT004dvmt00004
    • 2021-07-02
    161 min

    [JUL-642]The Married Masseuse Next Door Always Secretly Seduces And Teases Me Even Though My Wife Is Right Next To Us... Hijiri Maihara

  • kiyoshi maihara censoredmature womanslutJULmadonnakogoro kindaichiJUL-642JUL642jul00642
    • 2021-07-06
    113 min

    300NTK-600 Echi Echi Female President! !! Erection is inevitable with beautiful Tekanuru Ero treatment! !! A slender beauty body that is shiny! !! Of course, it’s a natural lotion from Mako, and it’s an erotic lewd constitution! !! Continuo

  • bodynn censoredcreampieamateurntkntk-600ntk600300ntk-600
    • 2021-07-20
    27 min

    FC2PPV 1932127 Up To 27 [Individual] In Order To Protect My Child, A Thirty Married Woman Who Goes Crazy With A Large Amount Of Vaginal Cum Shot On Three Strange Sticks From Day To Night In The Bedroom Of Her Parents’ House

  • amateur uncensoredfc2
    • 2021-08-17
    68 min

    FC2PPV 2038379 [Half Price Left, Fertilization Times! ] ♀ 237 Female College Student Shio ◯ -Chan 20 Years Old 3rd Time: A Devoted Blowjob Of A Fair-Skinned, Slope-Based Beautiful Girl With A Boyfriend, Vaginal Cum Shot, Fertilization, And Apt Pregna

  • amateur uncensoredfc2
    • 2021-08-21
    138 min

    [CEAD-357]Glasses Sex 3! Wan Horikita SEX Wearing Black Rimmed Glasses: Uniform, Glasses SEX: Recruit Suits & Glasses SEX And...

  • horikita wan censoredmature womansingle workCEADserebu no tomoCEAD-357CEAD357cead00357
    • 2021-09-04
    243 min

    [DSD-834]The Temptation Of A Bewitching Beauty And Her Huge Tits 3

  • julia ann clichy lynn censoredbig titsmature womanDSDmomotarou eizou shuppanmarchinsweetdevilDSD-834DSD834dsd00834
    • 2021-09-11
    240 min

    [NASH-563]Her Meaty Pussy Will Snugly Suck And Slurp At Your Cock Until You Unload Massive Ejaculations Of Cum! Thrust Your Semen Up Into Her Cunt! A 4-Hour Best Hits Collection Of Cowgirl Sex

  • censoredcreampiemarried womanNASHpinknadeshikoNASH-563NASH563nash00563
    • 2021-09-23
    120 min

    [RCTD-426]Lesbian Snake Lady

  • future sunohara chiharu sakurai censoredlesbiannurseRCTDrocketcentral yamamotoRCTD-426RCTD4261rctd00426
    • 2021-09-24
    15 min

    FC2PPV 2243734 Prefectural Ordinary Course ③ After School With A Super Sensitive Beautiful Girl With Beautiful Legs In A Thousand Years …

  • amateur uncensoredfc2
    • 2021-09-24
    117 min

    [DASD-920]Anal Sex With A Father-In-Law Whom I Hate To Death...The Foreign Wife Who Gets It Up Her Asshole. June Lovejoy

  • june lovejoy censoredanalcreampieDASDdassabasuhori nakaDASD-920DASD920dasd00920
    • 2021-10-10
    63 min

    SIRO-4655 [First Shot] [Minimum Momojiri Daughter] [Innocent Beauty] An S-Class Amateur Beauty With A Golden Ratio Of Beautiful Big Tits Appears In A Petite Body. A Beautiful White And Transparent Body That Will Captivate The Things You See Will Grad

  • amateur censoredbig titsamateursirosiro-4655siro4655siro-4655
    • 2021-10-15
    83 min

    [LBDD-005]Mahiro Ichiki A Pure And Pretty Beautiful Girl With Black Hair

  • mahiro ichiki censoredbeautiful girlsingle workLBDDmedia artsLBDD-005LBDD005162lbdd00005
    • 2021-10-23
    53 min

    10musume 102321_01 My Sex Is Often A One-Night-Only Meeting Yuna Okamoto

  • amateur uncensored10musume
    • 2021-10-28
    143 min

    [TOEN-053]First Time Shots of 39-Year Old Chinatsu Hashino. Amazing AV Debut of F-CUp Beautiful Tits!

  • chinatsu hashino censoredcreampiemarried womanTOENcenter villageyoichi sanotaoyuanTOEN-053TOEN053h-086toen00053
    • 2021-11-09
    62 min

    FC2PPV 2416957 Appeared For The First Time In Four And A Half Years. Chocolat Who Was Ubu Became An Adult As It Is Ubu ~ ☆

  • amateur uncensoredfc2



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download