aika




FC2VENXMIDVMIDEHDKAHZGDMILKVEMAEBODKBIFSDSSCAWDSQTEADNAWDSHKDWAAAHMNCESDHNDLULU

2020-12-08
60 min

Caribbeancom 120820-001 She reveals her true identity in bed Riina Okamoto

  • riina okamoto uncensoredcreampiehandjobcaribbeancom
    • 2020-12-12
    79 min

    [HHKL-076]When We Missed Our Last Train Home, I Spent The Entire Night Fucking My Part-Time Job Co-Worker Until The Break Of Dawn, And That Day, We Felt Like Lovers. Chiharu Sakurai

  • chiharu sakurai censoredcreampiebeautiful girlHHKLhunterspace nyanjirohhh groupHHKL-076HHKL076hhkl00076
    • 2020-12-14
    51 min

    FC2PPV 1590758 Two sets of immersive GoPro video and iPhone high quality Ver ❤️ Overwhelming beautiful girl JD Yuka and private Gonzo in the night pool ❤️ Clear real face with glasses removed ❤️ Purchase privilege available

  • amateur uncensoredfc2
    • 2020-12-14
    107 min

    POW-036 Sasaku

  • amateur censoredbig titsschoolgirlpowpow-036pow036pow-036
    • 2020-12-21
    138 min

    [CESD-962]Her One And Only Porn Performance! Devoted Wife Sells Her Body To Strangers To Support Her Laid Off Husband Asuka (36)

  • censoredcreampieamateurCESDceleb no tomoCESD-962CESD962cesd00962
    • 2020-12-24
    113 min

    [JRZE-016]Entering The Biz At 50! Ran Mizawa

  • ran misawa censoredcreampiemature womanJRZEcenter villagekotaro misatojurakuJRZE-016JRZE016h-086jrze00016
    • 2020-12-24
    129 min

    [MILK-097]Underground Idol Rin Kira Gets Taken Home By A Virgin Super Fan At An Event And Ends Up Fucking Him - Caught On Camera

  • kira rin censoredblowjobcosplayMILKmilkMILK-097MILK097h-1240milk00097
    • 2020-12-30
    158 min

    1Pondo 123020_001 Risa Onodera: Risa Onodera Special Edition

  • amateur uncensored1pondo
    • 2021-01-29
    43 min

    490FAN-090 Akari

  • amateur censoredbig titsamateurfanfan-090fan090490fan-090
    • 2021-01-29
    32 min

    480FRIN-017 《Personal shooting / voyeur》 Affair sex video leaked between a certain storyteller’s G cup wife and a junior entertainer

  • amateur censoredbig titsmarried womanfrinfrin-017frin017480frin-017
    • 2021-02-07
    240 min

    [MMB-348]Head Over Heels For Curvy, Soft, Squishy, Bouncy Marshmallow Bodies - 4 Hours

  • kina shinozaki shizuka omori censoredcreampieMMBmomotaro eizohakase ishikiribashimomotaro s bestMMB-348MMB348mmb00348
    • 2021-02-25
    167 min

    [NHDTB-494]These 2 Voluptuous Slut Babes Are Wearing Tight Knit Dresses And Hemming Me In With Their Big Asses, And When I Got n Erection, They Ejaculated Me With A Smile

  • censoredslutNHDTBnatural highlemonheart nakajimaNHDTB-494NHDTB4941nhdtb00494
    • 2021-02-27
    147 min

    [WAAA-037]It's OK To Make Her Pregnant! Adultery With A Super Sexy Horny Married Woman - Nene Tanaka

  • nene tanaka censoredcreampiebig titsWAAAwanz factorywanzWAAA-037WAAA037waaa00037
    • 2021-02-27
    139 min

    [MCSR-426]A Married Woman's Creampie Adultery Vacation - Riho Fujimori

  • riho fujimori censoredcreampiebig titsMCSRbig morkalyumejimascottMCSR-426MCSR42657mcsr00426
    • 2021-03-23
    48 min

    C0930 ki210323 Reiko Muraoka 49years old

  • amateur uncensoredc0930
    • 2021-04-09
    121 min

    [IPX-648]My Teacher Miss Kijima Shakes Her Hips Sweetly And Smiles As She Seduces And Fucks Younger Men Airi Kijima

  • airi kijima censoredslutsingle workIPXidea pocketdishIPX-648IPX648ipx00648
    • 2021-04-09
    54 min

    FC2PPV 1760348 [Bonus delivered] Semen injection into a young vagina born in 2002 Slender 19-year-old student Sacchan [Personal shooting] [Completely uncut]

  • amateur uncensoredfc2
    • 2021-04-13
    116 min

    [STARS-360](Get Your Nookie On In Overwhelming 4K Video!) Her True Nature: A Neo Slut Kaede Hiiragi This Predatory Beautiful Girl Will Use Both Her Holes To Devour Maso Men's Cocks! Listen To Her Suck And Slurp While Giving A Blowjob And Get Men

  • hiiragi kaede censoredbeautiful girlsingle workSTARSsod createdragon nishikawasod starSTARS-360STARS3601stars00360
    • 2021-04-21
    55 min

    FC2PPV 1780822 [No] [Appearance] [Review benefits] Super hard project! Sakura-chan 1 hour endurance SEX ♡ 5 shots in total ☆ Gachinko 3P orgy festival without break ☆

  • amateur uncensoredfc2
    • 2021-05-10
    61 min

    Caribbeancom 051021-001 Very First Anal Sex With Anger Reika Kudo

  • reika kudo uncensoredanalcreampiecaribbeancom
    • 2021-06-06
    36 min

    FC2PPV 1855564 [Personal shooting] ♀299 Professional student Ma ◯ -chan, 20 years old, 2nd time, will you get pregnant once! ？？ Menstruation stopped at the last seeding conceived AV debut! A vaginal cum shot that doubles as a pregnancy test! (Lol)

  • amateur uncensoredfc2
    • 2021-06-14
    27 min

    [PYU-172]Slut With Colossal Tits Gives Amateur Sub Guys A Titty Fuck And Twists Their Nipples Until They Moan With Ecstasy

  • censoredbig titsblowjobPYUcome camPYU-172PYU172h-1462pyu00172
    • 2021-06-20
    78 min

    413INST-132 [Celebrity / Outflow] [Secret personal photo session] with a drama actress who likes American comics [Gonzo SEX of memories with her]

  • amateur censoredcreampieamateurinstinst-132inst132413inst-132
    • 2021-07-07
    70 min

    ION-090 Kotone

  • amateur censoredsquirtingamateurionion-090ion090ion-090
    • 2021-07-18
    242 min

    [NASH-541]Sixty Something Grandma's Creampie From Her Step-Grandson's Giant Cock Reminds Her Of Orgasmic Delights She'd Almost Forgotten 3

  • saho imaizumi miyagi kanako censoredcreampiemature womanNASHnadeshikojun nagasawaNASH-541NASH541nash00541
    • 2021-07-23
    101 min

    [SQTE-377]Tease My Nipples, Touch Them, Lick Them, Pinch Them: Marina Saito

  • marina saito censoredsquirtinguniformSQTEs cuteSQTE-377SQTE377sqte00377
    • 2021-07-29
    61 min

    336KNB-165 An Immoral Married Woman Who Applied For AV With Interestingness Exposing Her Plenty Of Body, Shaking Beautiful Big Tits And Disturbed With Other Sticks! I Will Take A Gonzo With This Married Woman From Now On. 58 At Kisarazu Station, Kisa

  • amateur censoredbig titsmarried womanknbknb-165knb165336knb-165
    • 2021-08-10
    480 min

    [KTRA-323]Chonky! 10 Big Tits Girls With Selfish Bodies Continuous Fucking For 8 Hours 2 Dics

  • roko kishibe white peach censoredbig titsKTRAk tribeKTRA-323KTRA323h-094ktra00323
    • 2021-08-10
    480 min

    [KTRA-322]Tiny-Breasted A-Cup Beautiful Girls: A Succession Of SEX With Ten Girls For 8 Hours: 2-DVD Set.

  • mie yazawa shinozaki mio censoredcreampiebeautiful girlKTRAke toraibuk tribeKTRA-322KTRA322h-094ktra00322
    • 2021-08-21
    149 min

    [APKH-184]Mating With A Beauty In A Love Hotel A Beautiful Face But With Nasty Pubic Hair! Personal Sex Tape Of My Immoral Relations With A Female S*****t Who Loves Older Men And Begs For A Creampie. Suzu Takayama

  • takayama tin censoredcreampieschoolgirlAPKHaurora project annexhAPKH-184APKH184apkh00184
    • 2021-09-04
    127 min

    [EMBZ-233](Caution Before Viewing) A G*******g Fuck Fest Video Uncut And Unedited A Video Record Of Sins Against Women A Voluptuous Lady Is Detonated! This Plain Jane Colossal Tits Housewife In Glasses Is Going Cum Crazy With Aphrodisiacs And Orgasmi

  • shiori tsukada censoredcreampiesingle workEMBZjuku onna juku emmanuellejuku onna jukuEMBZ-233EMBZ233embz00233
    • 2021-09-04
    110 min

    [AWD-129]Fakecest: My Stepmom"s Perfect Ass - The Big Ass Of My Sexually Maniacal and Perverted Stepmom, Hitomi Misono

  • hitomi misono censoredbig titsmature womanAWDrubyyanoguchi susumunext doorAWD-129AWD129awd00129
    • 2021-09-09
    60 min

    476MLA-049 [Recorded Video Ww That Inserts With Cheating Sex Even Though He Has A Boyfriend And Tricks A Member Of A Transcendental Bitch Troupe Into A Semen Pack]

  • amateur censoredcreampieamateurmlamla-049mla049476mla-049
    • 2021-09-10
    119 min

    [DASD-912]Light Skin Slender Girlfriend Cheats On Me With My Dad And Gets Fucked. Hono Konomi

  • yoshimi hono censoredcreampieschoolgirlDASDdasrokusaburo mishimaDASD-912DASD912dasd00912
    • 2021-10-09
    58 min

    H0930 tk0043 Yukie Nishiaki 35years old

  • amateur uncensoredh0930
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-03
    66 min

    SIRO-4686 [First Shot] [Beautiful Ass With Just The Right Amount Of Flesh] [Slender Beauty] An Apparel Clerk With Neat Looks And Bell-Shaped Beautiful Breasts Has Appeared. The Body That Was Pierced Violently From The Back And Culminated Many Times W

  • amateur censoredbig titsamateursirosiro-4686siro4686siro-4686
    • 2021-11-05
    123 min

    [IPX-758]From Morning to Night, When You are Away from Home, Your Father Continues to Make Me Come by Licking Me With His Tongue and With His Tongue Techniques... Karen Kaede

  • karen kaede censoredsingle workdramaIPXidea pocketdoragon nishikawatissueIPX-758IPX758ipx00758
    • 2021-11-16
    480 min

    [MUCH-140]Really Huge Tits Collection Sex With 10 Girls Fucked One After The Other 8 Hours 2 Discs

  • aoi kuroki enomiya censoredbig titsMUCHmothermuchimuchiMUCH-140MUCH140h-796much00140
    • 2021-12-03
    58 min

    483SGK-056 [Sex Addicted Female College Student] [Skin Smooth Super Pie Bread] [Super Do M With A Beautiful Face] "I Want To Have Sex Every Day In The Morning, Noon, Evening, Lol" Unrivaled Sex Junkie Super Advent! Real Sex Of An Active Femal

  • amateur censoredamateursgksgk-056sgk056483sgk-056
    • 2021-12-03
    180 min

    [MIDV-013]Quiet, Anti-social Longtime Friend Offers Irresistible Temptation. Full-on Panty Shot Showoff. Catching A Glimpse Gives Me A Huge Bulge From My Big Dick, Making Her Hot And Soaking Wet With Excitement When She Sees It! Hana Kotone

  • ryoko sena miu natsume miu harukawa lisa natsume iori censoredlesbianmature womanMIDVmoodyzgoemonmoodyz divaMIDV-013MIDV01348midv00013
    • 2021-12-25
    69 min

    C0930 tk0049 Hiroko Hayashizaki 30years Old

  • amateur uncensoredc0930
    • 2022-01-13
    57 min

    FCP-064 [Delivery Only] Even Though It’s A Shop Without A Nuisance … Super-Excessive Service Will Blow Away Fatigue And Sperm! !! Repeat Confirmed! Squeezing Men’s Esthetic ＃ 4

  • amateur censoredamateurbeautiful girlfcpfcp-064fcp064fcp-064
    • 2022-01-13
    108 min

    [SPRD-1503]My Son-In-Law. The Son-In-Law, Who Has Strong Sexual Desires, Falls Madly In Love With His Mother-In-Law. Akari Maya.

  • shinya akari censoredmature womansingle workSPRDtakara eizosanpei suminekoaleddinSPRD-1503SPRD150318sprd01503
    • 2022-01-15
    123 min

    [ZOCM-019]Going Crazy By Pulling Out At The Last Second! Bringing You A Shameful Lewd Beautiful Y********l in Uniform. Rina Hinata

  • hyuga rina censoredcreampiebig titsZOCMzokuzoku musume mousouzokutodozokuzoku musumeZOCM-019ZOCM019zocm00019
    • 2022-01-21
    160 min

    [MDTE-022]The Beautiful Shaved Pussy Bitch Gal. Creampie Mating. Riria.

  • censoredcreampieblowjobMDTEuchu kikakutetMDTE-022MDTE022mdte00022
    • 2022-01-22
    300 min

    [BDSR-471]Do You Like Beautiful Anal？ 10 Beautiful Married Woman Climaxing Through Their Asses - 5 Hours

  • censoredanalBDSRbig morkaltakeda banderasBDSR-471BDSR47157bdsr00471
    • 2022-01-27
    130 min

    [STARS-488]「パパの事、男として見ちゃうの…」大好きな義父を犯し続けた一夜…。外は寒いけど唇が燃えるようなベロキス性交 唯井まひろ

  • tadai mahiro censoredSTARSsod createhitoshi nimuraSTARS-488STARS488



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download