slut




FC2AUKGWAAAJUFEPREDCHRVMIAAFSDSSMILKSSISVENXKSBJMIDERBDHDKAADNNGODWANZAPODNATRABW

2018-04-08
179 min

[CESD-551]Chisato Shoda Dirty Spread Legs 3 SEX

  • shota chisato censoredmature womanslutCESDcelebrity friendsCESD-551CESD551cesd00551
    • 2018-04-07
    119 min

    [MIDE-534]Getting Pile-drive Fucked By Fat Ass Slut (Minami Hatsukawa)

  • hatsukawa minami censoredbeautiful girlslutMIDEmoodyzsuisei akaimoodyz divaMIDE-534MIDE534mide00534
    • 2018-04-07
    150 min

    [SSNI-175]This Devilish Little Sister Will Make Your Daydream Fantasies Cum True In This Sure Thing Erotic Situation Koharu Suzuki

  • suzuki koharu censoredbig titssquirtingSSNIs one number one stylekyouseis1 no 1 styleSSNI-175SSNI175ssni00175
    • 2018-04-07
    118 min

    [MEYD-365]This Horny Housewife Is Working A Secret Part-Time Job As A Delivery Health Call Girl Giving Oiled Up Pussy Grinding Services With Amazing Ass Shaking Speed And Letting Her Customers' Dicks Slip Into Her Pussy Misaki Honda

  • honda cape censoredcreampiemarried womanMEYDtameike gorotadashi komagomeMEYD-365MEYD365meyd00365
    • 2018-04-07
    118 min

    [WANZ-735]We're Stealing Away From Our Parents When My Big Sister Lures Me To Temptation With Thrilling Creampie Sex Minori Kawana

  • real village henan censoredcreampiebeautiful girlWANZwanz factorywanzWANZ-735WANZ735wanz00735
    • 2018-04-07
    119 min

    [MIAE-222]My Girlfriend's Best Friend Came To My Place To Stay Over, And For 2 Straight Days, She Kept On Whispering Sweet Nothings Into My Ear, So I Had Infidelity Sex With Her And Made Sure That Nobody Would Find Out Rika Mari

  • mari rika censoredbeautiful girlslutMIAEmoody susapyonmoodyz acidMIAE-222MIAE222miae00222
    • 2018-04-07
    162 min

    [BF-540]This Lady Boss With A Big Ass Is Giving Her Employees A Sex Education From Behind With A Lesson In Forced Creampie Temptation! Yu Shinoda

  • shinoda yu censoredcreampieslutBFbefreebatten kyushu manBF-540BF540bf00540
    • 2018-04-07
    216 min

    [MIDE-537]Total Domain The Temptation Of A Totally Horny Elder Sister In Knee-High Socks Chinami Ito

  • chinami ito censoredcosplayslutMIDEmoodyzMIDE-537MIDE537
    • 2018-04-07
    150 min

    [JUY-452]This Married Woman Will Sweetly Lure You To Temptation Ayane Haruka

  • ayane haruka censoredmature womanslutJUYmadonnasatsugu koyamaJUY-452JUY452juy00452
    • 2018-04-07
    58 min

    [040718_246]Kiyomii Nakazono

  • amateur uncensoredbig titsblowjobpacopacomama
    • 2018-04-07
    150 min

    [JUY-462]Her Husband Is Coaching The Track Team And She Wants Their Rock Hard Cocks So Bad It Hurts A Blowjob-Addicted Horny Housewife Mako Oda

  • oda mako censoredbig titsmarried womanJUYmadonnaichiro kanedaJUY-462JUY462juy00462
    • 2018-04-07
    119 min

    [MIDE-541]She's Covered In Cum But Still Willing To Clean Off Your Dick With A Nice Blowjob Suzu Hirasawa An Ultra Pleasurable Dick Sucking Full Course Meal

  • hirasawa tin censoredblowjobbeautiful girlMIDEmoodyzkirinmoodyz divaMIDE-541MIDE541mide00541
    • 2018-04-06
    153 min

    [DMOW-171]The Dirty Talk Teacher And The Maso Man 3 Yuri Nikaido

  • yuri nikaido censoredbig titsslutDMOWoffice k smaboroshikomowDMOW-171DMOW17136dmow00171
    • 2018-04-06
    242 min

    [WSP-136]Even Ugly Men Can Give Erotic Kisses To Beautiful Women And Make French Kiss Love 5

  • yoko kokoro nozomi tanihara censoredslutWSPwarp entertainmentsWSP-136WSP1362wsp00136
    • 2018-04-06
    241 min

    [HFD-163]Rape Love Miki Sunohara

  • future sunohara censoredblowjobslutHFDdream ticketHFD-163HFD16324hfd00163
    • 2018-04-06
    120 min

    [DBDR-005]Asahi Mizuno Is Visiting A Popular Hot Springs Resort In Tochigi Prefecture, And Going In Undercover ! Using Her Alluring Beautiful Tits And Technique, How Many Shots Of Rich And Thick Semen Can She Milk From The Male Guests At This Establi

  • mizuno chaoyang censoredbig titsmature womanDBDRdbadova daisakusen herobattle of dbadovaDBDR-005DBDR005dbdr00005
    • 2018-04-06
    120 min

    [CMD-015]Temptation Hair Dresser Sumire Mizugawa

  • mizukawa violet censoredblowjobslutCMDdream ticketCMD-015CMD01524cmd00015
    • 2018-04-06
    42 min

    FC2PPV 806892 [Personal shooting] Super cute female college student Ayaka and Muchimuchi Slut play and raw vaginal cum shot!

  • amateur uncensoredfc2
    • 2018-04-06
    125 min

    [DOKS-428]Blowjob Fun With Aggressive Hand Action

  • minami sena airi hatta censoredblowjobslutDOKSoffice k sforever youngDOKS-428DOKS42836doks00428
    • 2018-04-06
    66 min

    [WKD-003]W.O.M.A.N. In Full Bloom Mio Kimijima

  • kimishima mio censoredbig titsslutWKDwarp entertainmentk westwWKD-003WKD0032wkd00003
    • 2018-04-06
    117 min

    [ONEZ-132]This Ultra Slut Beautiful Girl Is Tempting Me With Braless Nip Slips And She's A Perverted Bitch Who Loves To French Kiss! Himari-chan Works At A Uniform Cafe

  • censoredcreampieuniformONEZprestigetodoONEZ-132ONEZ132118onez00132
    • 2018-04-05
    90 min

    [MESU-068]This Actually Happened! A Totally Ripe Life Insurance Sales Lady And Her Creampie Sales Technique Eri Sonozaki

  • eri sonozaki censoredcreampiemarried womanMESUcenter villagesouthern earthred snowMESU-068MESU068h-086mesu00068
    • 2018-04-04
    130 min

    [GVG-662]The Embarassingly Sensitive Nipples Of A Girl With Tiny Boobs And No Bra Kana Manaka

  • ok censoredslutsingle workGVGglory questupdatingGVG-662GVG66213gvg00662
    • 2018-04-04
    135 min

    [GVG-661]My Colossal Tits Big Sister Is Tempting Me 24 Hours A Day And I Don't Know What To Do Kaho Shibuya

  • kaho shibuya censoredbig titsslutGVGglory questnukumizu kentaGVG-661GVG66113gvg00661
    • 2018-04-04
    14 min

    [040418_244]Marina Matsumoto

  • amateur uncensoredbig titsslutpacopacomama
    • 2018-04-04
    121 min

    [OVG-077]The Piston Cowgirl

  • hikaru konno kawamura maya censoredcreampieslutOVGglory questOVG-077OVG07713ovg00077
    • 2018-04-04
    479 min

    [YVG-017]Writhing And Moaning!! Self Shot Masturbation 8 Hours!! vol. 2

  • censoredslutYVGglory questYVG-017YVG01713yvg00017
    • 2018-04-04
    127 min

    [GVG-659]Anal Sex Dirty Talk Honoka Mihara

  • mihara honoka censoredanalslutGVGglory questyumeno aidaGVG-659GVG65913gvg00659
    • 2018-04-03
    46 min

    [200GANA-1688]マジ軟派、初撮。 1059

  • amateur censoredamateurslutganagana-1688gana1688200gana-1688
    • 2018-04-01
    100 min

    [ANB-144]I Became My Mom's Sex Toy An Alluring Hot Mother-In-Law And Her Rich And Rewarding Body! Reiko Tojo

  • reimi tojo censoredmature womanslutANBrubysusumu yanoguchinobleANB-144ANB144anb00144
    • 2018-04-01
    97 min

    [KCDA-218]High-cut Leggings Photoshoot 3

  • censoredbig titsslutKCDAdigital arkdigital ark digital arkKCDA-218KCDA218kcda00218
    • 2018-04-01
    101 min

    [VEC-304]This Wife Was Forced To Cum In Front Of Her Husband By A Molester Mao Kurata

  • kurata mao censoredcreampiemature womanVECvenuskaniemegami venusVEC-304VEC304vec00304
    • 2018-04-01
    125 min

    [ZEX-347][No Script, No Acting] 3 One On One Private Sex Battles!! She Went To The Home Of An AV Director And They Filmed Themselves In A Furious Private Fuck Fest! Lenon Kanae

  • kanae lennon censoredslutsingle workZEXpeters maxZEX-347ZEX347h-720zex00347
    • 2018-04-01
    92 min

    [VEC-305]My Mom's Best Friend Sasa Kanzaki

  • kanzaki censoredcreampiebig titsVECvenustamatsuka bingogoddess venusVEC-305VEC305vec00305
    • 2018-04-01
    134 min

    [KCDA-219]Voluptuous Schoolgirl Hot Dogging In Bloomers Greatest Hits Collection

  • censoredbig titsslutKCDAdigital arcdigital arkKCDA-219KCDA219kcda00219
    • 2018-04-01
    124 min

    [FLAV-189]Bunny Ryo Arimori

  • ryo arimori miyu tokohara censoredbig titsslutFLAVdigital arcdigital arkFLAV-189FLAV189flav00189
    • 2018-04-01
    137 min

    [FCDC-095]This Horny Slutty Big Tits Office Lady Likes To Tempt The Male Employees Wearing A Micro Miniskirt Rina Ayana

  • rina ayana akari nanara censoredbig titsslutFCDCweekenderFCDC-095FCDC095fcdc00095
    • 2018-04-01
    93 min

    [VOSS-084]My Lady Boss Missed The Last Train Home After A Drinking Party, So Now She And I Were Alone Together At My House She Was Pretending To Be Drunk And Victimizing Me! She Kept Pawing At My Body And When This Meat Eating Lady Pumped Me So Hard

  • censoredcreampiemature womanVOSSvenussaruthe matures projectVOSS-084VOSS084voss00084
    • 2018-04-01
    231 min

    [OYC-174]I Joined A Slut Social Club And Thought I Would Have A Good Time, But I Ended Up Getting Eaten Alive By These Horny Ladies! I Joined This Social Club Rumored To Be A Slut Club In Hopes Of Getting A Cherry Boy Popping! And Finally The Day Of

  • censoredOYCoyashoku.companyspace nyanjirohhh groupOYC-174OYC174oyc00174
    • 2018-03-31
    145 min

    [JUY-442]She'll Suck You Dry From Your Balls To The Tip Of Your Cock!! A Beautiful Married Woman Gives A Naughty Blowjob Ayana Mimasaka

  • mimasaka ayame censoredmarried womanblowjobJUYmadonnamamezawa mametaroJUY-442JUY442juy00442
    • 2018-03-31
    155 min

    [IPX-120]Rich And Thick Saliva Splattering Slobbering Kisses And Sex With A Big Titty Elder Sister Momo Sakura

  • sakura sky momo censoredbig titsslutIPXidea pocketusa pyondishIPX-120IPX120ipx00120
    • 2018-03-31
    22 min

    [276KITAIKE-214]つばさ 2

  • amateur censoredbig titsamateurkitaikekitaike-214kitaike214276kitaike-214
    • 2018-03-31
    118 min

    [HND-501]Unlimited Ejaculations From 30 Cocks Large Orgies Creampie Raw Footage AIKA

  • aika censoredcreampieslutHNDbooktequilatinoHND-501HND501hnd00501
    • 2018-03-31
    65 min

    [033118_242]Noa Yonekura

  • noa yonekura uncensoredcreampieblowjobpacopacomama
    • 2018-03-31
    23 min

    [276KITAIKE-213]さやか

  • amateur censoredbig titsamateurkitaikekitaike-213kitaike213276kitaike-213
    • 2018-03-31
    159 min

    [HND-498]An Elder Sister Slut Who Will Keep On Milking You By Luring You To Temptation With Amazing Nipple Tweaking Creampie Sex Akari Mitani

  • mitani akari censoredcreampiebeautiful girlHNDhonnakarassha miyoshiHND-498HND498hnd00498
    • 2018-03-31
    120 min

    [HND-500]We're Sending Sora Shiina To A Delivery Health Service Where Fucking Is Not Allowed She's Spending The Day As A Trial Employee And Visiting Surprised Customers At Their Homes!! If They Can Resist Her AV Actress Techniques And Pussy G

  • shiina sky censoredcreampieslutHNDhon nakamiyoshi rusherHND-500HND500hnd00500
    • 2018-03-31
    120 min

    [CJOD-136]Ejaculating Until Morning In A Babymaking Sex Fuck Fest Ai Hoshina

  • sena ai censoredcreampieslutCJODbieightCJOD-136CJOD136cjod00136



    • Japanese porn for free, Javsushi, Jav sushi sex food everyday, JAVHD uncensored free download